Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

SCN3B antibody

Antigen

SCN3B

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN633798
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen SCN3B antibody was raised using the N terminal of SCN3B corresponding to a region with amino acids RPEGGKDFLIYEYRNGHQEVESPFQGRLQWNGSKDLQDVSITVLNVTLND
Description SCN3B is one member of the sodium channel beta subunits of voltage-gated sodium channels, which are responsible for the generation and propagation of action potentials in neurons and muscle. SCN3B influences the inactivation kinetics of the sodium channel.
Molecular Weight 24 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCN3B antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Neurology, Apoptosis/Necrosis

Alternatives

Alternatives for antigen "SCN3B", type "Antibodies"
Hosts Rabbit (19)
Reactivities Human (18), Mouse (Murine) (17), Rat (Rattus) (17), Cow (Bovine) (13), Dog (Canine) (12), Pig (Porcine) (12), Chicken (9), Sheep (Ovine) (8), Rabbit (4), Horse (Equine) (3)
Applications Flow Cytometry (FACS) (16), Immunofluorescence (IF) (15), ELISA (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Western Blotting (WB) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)