C21orf62 antibody (Middle Region)

Catalog No. ABIN633839

The Rabbit Polyclonal anti-C21orf62 antibody is suitable to detect C21orf62 in samples from Human. It has been validated for WB.

Quick Overview for C21orf62 antibody (Middle Region) (ABIN633839)

Target: C21orf62 (Chromosome 21 Open Reading Frame 62 (C21orf62))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C21orf62 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-C21orf62 Antibody

Binding Specificity: Middle Region

Specificity: C21 ORF62 antibody was raised against the middle region of C21 rf62

Purification: Affinity purified

Immunogen: C21 ORF62 antibody was raised using the middle region of C21 rf62 corresponding to a region with amino acids STNTLPTEYLAICGLKRLRINMEAKHPFPEQSLLIHSGGDSDSREKPMWL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C21ORF62 Blocking Peptide, (ABIN5612493), is also available for use as a blocking control in assays to test for specificity of this C21ORF62 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C20 RF62 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C21orf62

Target: C21orf62 (Chromosome 21 Open Reading Frame 62 (C21orf62))

Alternative Name: C21ORF62

Background: The function of C21orf62 protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 28 kDa (MW of target protein)