FBLN4 antibody (Middle Region)

Catalog No. ABIN633884

The Rabbit Polyclonal anti-FBLN4 antibody is suitable to detect FBLN4 in samples from Human. It has been validated for WB.

Quick Overview for FBLN4 antibody (Middle Region) (ABIN633884)

Target: FBLN4 (Fibulin 4 (FBLN4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FBLN4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FBLN4 Antibody

Binding Specificity: Middle Region

Specificity: EFEMP2 antibody was raised against the middle region of EFEMP2

Purification: Affinity purified

Immunogen: EFEMP2 antibody was raised using the middle region of EFEMP2 corresponding to a region with amino acids VSAMLVLARPVTGPREYVLDLEMVTMNSLMSYRASSVLRLTVFVGAYTF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

EFEMP2 Blocking Peptide, (ABIN5613312), is also available for use as a blocking control in assays to test for specificity of this EFEMP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EFEMP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FBLN4

Target: FBLN4 (Fibulin 4 (FBLN4))

Alternative Name: EFEMP2

Background: A large number of extracellular matrix proteins have been found to contain variations of the epidermal growth factor (EGF) domain and have been implicated in functions as diverse as blood coagulation and activation of complement.

Molecular Weight: 49 kDa (MW of target protein)