PCCB antibody (Middle Region)

Catalog No. ABIN633897

The Rabbit Polyclonal anti-PCCB antibody (ABIN633897) specifically detects PCCB in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for PCCB antibody (Middle Region) (ABIN633897)

Target: PCCB (Propionyl CoA Carboxylase beta Polypeptide (PCCB))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCCB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCCB Antibody

Binding Specificity: Middle Region

Specificity: PCCB antibody was raised against the middle region of PCCB

Purification: Affinity purified

Immunogen: PCCB antibody was raised using the middle region of PCCB corresponding to a region with amino acids PGFLPGTAQEYGGIIRHGAKLLYAFAEATVPKVTVITRKAYGGAYDVMSS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCCB Blocking Peptide, (ABIN5615239), is also available for use as a blocking control in assays to test for specificity of this PCCB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCCB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCCB

Target: PCCB (Propionyl CoA Carboxylase beta Polypeptide (PCCB))

Alternative Name: PCCB

Background: PCCB is a subunit of the propionyl-CoA carboxylase (PCC) enzyme, which is involved in the catabolism of propionyl-CoA. PCC is a mitochondrial enzyme that probably acts as a dodecamer of six alpha subunits and six beta subunits. Defects in this gene are a cause of propionic acidemia type II (PA-2).

Molecular Weight: 58 kDa (MW of target protein)

Pathways: Monocarboxylic Acid Catabolic Process