Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

EGF-Containing Fibulin-Like Extracellular Matrix Protein 1 (EFEMP1) antibody

Antigen

EGF-Containing Fibulin-Like Extracellular Matrix Protein 1 (EFEMP1)

Synonyms DHRD, DRAD, FBNL, MLVT, MTLV, S1-5, FBLN3, FLJ35535, MGC111353, MGC37612, T16, EFEMP1, MGC148456
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN633923
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name EFEMP1
Immunogen EFEMP1 antibody was raised using the middle region of EFEMP1 corresponding to a region with amino acids KYMSIRSDRSVPSDIFQIQATTIYANTINTFRIKSGNENGEFYLRQTSPV
Description EFEMP1 genepans approximately 18 kb of genomic DNA and consists of 12 exons. Alternative splice patterns in the 5' UTR result in three transcript variants encoding the same extracellular matrix protein. Mutations in this gene are associated with Doyne honeycomb retinal dystrophy.
Molecular Weight 53 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EFEMP1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Neurology

Alternatives

Alternatives for antigen "EGF-Containing Fibulin-Like Extracellular Matrix Protein 1 (EFEMP1)", type "Antibodies"
Hosts Rabbit (4), Mouse (2)
Reactivities Human (3), Mouse (Murine) (1), Rat (Rattus) (1)
Applications Western Blotting (WB) (6), ELISA (2), Flow Cytometry (FACS) (2)