FGL1 antibody (Middle Region)

Catalog No. ABIN633938

The Rabbit Polyclonal anti-FGL1 antibody is suitable to detect FGL1 in samples from Human. It has been validated for WB.

Quick Overview for FGL1 antibody (Middle Region) (ABIN633938)

Target: FGL1 (Fibrinogen-Like 1 (FGL1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FGL1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FGL1 Antibody

Binding Specificity: Middle Region

Specificity: FGL1 antibody was raised against the middle region of FGL1

Purification: Affinity purified

Immunogen: FGL1 antibody was raised using the middle region of FGL1 corresponding to a region with amino acids EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

FGL1 Blocking Peptide, (ABIN937799), is also available for use as a blocking control in assays to test for specificity of this FGL1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for FGL1

Target: FGL1 (Fibrinogen-Like 1 (FGL1))

Alternative Name: FGL1

Background: Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins.

Molecular Weight: 34 kDa (MW of target protein)