B3GALNT2 antibody (Middle Region)

Catalog No. ABIN633947

The Rabbit Polyclonal anti-B3GALNT2 antibody is suitable to detect B3GALNT2 in samples from Human and Mouse. It has been validated for WB.

Quick Overview for B3GALNT2 antibody (Middle Region) (ABIN633947)

Target: B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GALNT2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-B3GALNT2 Antibody

Binding Specificity: Middle Region

Specificity: B3 GALNT2 antibody was raised against the middle region of B3 ALNT2

Purification: Affinity purified

Immunogen: B3 GALNT2 antibody was raised using the middle region of B3 ALNT2 corresponding to a region with amino acids PESFEGTIVWESQDLHGLVSRNLHKVTVNDGGGVLRVITAGEGALPHEFL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B3GALNT2 Blocking Peptide, (ABIN5612254), is also available for use as a blocking control in assays to test for specificity of this B3GALNT2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B3GALNT2

Target: B3GALNT2 (beta-1,3-N-Acetylgalactosaminyl Transferase 2 (B3GALNT2))

Alternative Name: B3GALNT2

Background: B3GALNT2 is the beta-1,3-N-acetylgalactosaminyltransferase active in synthesizing a unique carbohydrate structure, GalNAc-beta-1-3GlcNAc, on N- and O-glycans. B3GALNT2 has no galactose nor galactosaminyl transferase activity toward any acceptor substrate.

Molecular Weight: 57 kDa (MW of target protein)