SFTPB antibody (Middle Region)

Catalog No. ABIN633984

The Rabbit Polyclonal anti-SFTPB antibody (ABIN633984) specifically detects SFTPB in WB. The antibody is reactive with Human and Rat samples.

Quick Overview for SFTPB antibody (Middle Region) (ABIN633984)

Target: SFTPB (Surfactant Protein B (SFTPB))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SFTPB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SFTPB Antibody

Binding Specificity: Middle Region

Specificity: SFTPB antibody was raised against the middle region of SFTPB

Purification: Affinity purified

Immunogen: SFTPB antibody was raised using the middle region of SFTPB corresponding to a region with amino acids PGALQARPGPHTQDLSEQQFPIPLPYCWLCRALIKRIQAMIPKGALAVAV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SFTPB Blocking Peptide, (ABIN5616108), is also available for use as a blocking control in assays to test for specificity of this SFTPB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFTPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SFTPB

Target: SFTPB (Surfactant Protein B (SFTPB))

Alternative Name: SFTPB

Background: SFTPB is the pulmonary-associated surfactant B protein (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a lipid-rich material that prevents lung collapse by lowering surface tension at the air-liquid interface in the alveoli of lung. SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Surfactant is composed of phospholipids and other surfactant-associated proteins.

Molecular Weight: 42 kDa (MW of target protein)