PCSK1 antibody (Middle Region)

Catalog No. ABIN633993

The Rabbit Polyclonal anti-PCSK1 antibody (ABIN633993) specifically detects PCSK1 in WB. The antibody is reactive with Human samples.

Quick Overview for PCSK1 antibody (Middle Region) (ABIN633993)

Target: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCSK1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCSK1 Antibody

Binding Specificity: Middle Region

Specificity: PCSK1 antibody was raised against the middle region of PCSK1

Purification: Affinity purified

Immunogen: PCSK1 antibody was raised using the middle region of PCSK1 corresponding to a region with amino acids QSPKKSPSAKLNIPYENFYEALEKLNKPSQLKDSEDSLYNDYVDVFYNTK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCSK1 Blocking Peptide, (ABIN5615263), is also available for use as a blocking control in assays to test for specificity of this PCSK1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCSK1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCSK1

Target: PCSK1 (Proprotein Convertase Subtilisin/kexin Type 1 (PCSK1))

Alternative Name: PCSK1

Background: PCSK1 is involved in the processing of hormone and other protein precursors at sites comprised of pairs of basic amino acid residues. Substrates include POMC, renin, enkephalin, dynorphin, somatostatin and insulin.

Molecular Weight: 71 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism