APOA4 antibody (C-Term)

Catalog No. ABIN634002

The Rabbit Polyclonal anti-APOA4 antibody (ABIN634002) specifically detects APOA4 in WB. The antibody is reactive with Human samples.

Quick Overview for APOA4 antibody (C-Term) (ABIN634002)

Target: APOA4 (Apolipoprotein A-IV (APOA4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOA4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APOA4 Antibody

Binding Specificity: C-Term

Specificity: ApoA-IV antibody was raised against the C terminal of APOA4

Purification: Affinity purified

Immunogen: ApoA-IV antibody was raised using the C terminal of APOA4 corresponding to a region with amino acids RQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKEKESQDKTLSLPELEQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoA-IV Blocking Peptide, (ABIN5612111), is also available for use as a blocking control in assays to test for specificity of this ApoA-IV antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOA4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOA4

Target: APOA4 (Apolipoprotein A-IV (APOA4))

Alternative Name: ApoA-IV

Background: The gene encoding APOA4 protein contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'UTR of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo A-IV is a potent activator of lecithin-cholesterol acyltransferase in vitro.

Molecular Weight: 43 kDa (MW of target protein)

Pathways: Lipid Metabolism