Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

LY6/PLAUR Domain Containing 4 (LYPD4) antibody

Antigen

LY6/PLAUR Domain Containing 4 (LYPD4)

Synonyms SMR, MGC42718, MGC58778, 4933400F01Rik, MGC133841, rCG53718, LYPD4
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634028
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name LYPD4
Immunogen LYPD4 antibody was raised using the N terminal of LYPD4 corresponding to a region with amino acids MGPQHLRLVQLFCLLGAISTLPRAGALLCYEATASRFRAVAFHNWKWLLM
Description The specific function of LYPD4 is not yet known.
Molecular Weight 27 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LYPD4 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "LY6/PLAUR Domain Containing 4 (LYPD4)", type "Antibodies"
Hosts Rabbit (1)
Reactivities Human (1)
Applications ELISA (1), Western Blotting (WB) (1)