PAPPA2 antibody (N-Term)

Catalog No. ABIN634034

The Rabbit Polyclonal anti-PAPPA2 antibody is suitable to detect PAPPA2 in samples from Human. It has been validated for WB.

Quick Overview for PAPPA2 antibody (N-Term) (ABIN634034)

Target: PAPPA2 (Pappalysin 2 (PAPPA2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PAPPA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PAPPA2 Antibody

Binding Specificity: N-Term

Specificity: PAPPA2 antibody was raised against the N terminal of PAPPA2

Purification: Affinity purified

Immunogen: PAPPA2 antibody was raised using the N terminal of PAPPA2 corresponding to a region with amino acids PPDLTENPAGLRGAVEEPAAPWVGDSPIGQSELLGDDDAYLGNQRSKESL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PAPPA2 Blocking Peptide, (ABIN5615212), is also available for use as a blocking control in assays to test for specificity of this PAPPA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAPPA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PAPPA2

Target: PAPPA2 (Pappalysin 2 (PAPPA2))

Alternative Name: PAPPA2

Background: PAPPA2 is a metalloproteinase which specifically cleaves IGFBP-5. It shows limited proteolysis toward IGFBP-3.

Molecular Weight: 92 kDa (MW of target protein)