PLA1A antibody (Middle Region)

Catalog No. ABIN634039

This Rabbit Polyclonal antibody specifically detects PLA1A in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PLA1A antibody (Middle Region) (ABIN634039)

Target: PLA1A (Phospholipase A1 Member A (PLA1A))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PLA1A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PLA1A Antibody

Binding Specificity: Middle Region

Specificity: PLA1 A antibody was raised against the middle region of PLA1

Purification: Affinity purified

Immunogen: PLA1 A antibody was raised using the middle region of PLA1 corresponding to a region with amino acids TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PLA1A Blocking Peptide, (ABIN5615401), is also available for use as a blocking control in assays to test for specificity of this PLA1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PLA1A

Target: PLA1A (Phospholipase A1 Member A (PLA1A))

Alternative Name: PLA1A

Background: Phosphatidylserine-specific phospholipase A1-alpha (PLA1A) acts specifically on phosphatidylserine (PS) and 1-acyl-2-lysophosphatidylserine (lyso-PS) to hydrolyze fatty acids at the sn-1 position of these phospholipids.

Molecular Weight: 50 kDa (MW of target protein)