CHAD antibody (Middle Region)

Catalog No. ABIN634043

The Rabbit Polyclonal anti-CHAD antibody is suitable to detect CHAD in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for CHAD antibody (Middle Region) (ABIN634043)

Target: CHAD (Chondroadherin (CHAD))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CHAD antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CHAD Antibody

Binding Specificity: Middle Region

Specificity: Chondroadherin antibody was raised against the middle region of CHAD

Purification: Affinity purified

Immunogen: Chondroadherin antibody was raised using the middle region of CHAD corresponding to a region with amino acids LSPLVNLFILQLNNNKIRELRAGAFQGAKDLRWLYLSENALSSLQPGALD

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Chondroadherin Blocking Peptide, (ABIN5612854), is also available for use as a blocking control in assays to test for specificity of this Chondroadherin antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CHAD antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CHAD

Target: CHAD (Chondroadherin (CHAD))

Alternative Name: Chondroadherin

Background: Chondroadherin is a cartilage matrix protein thought to mediate adhesion of isolated chondrocytes. CHAD contains 11 leucine-rich repeats flanked by cysteine-rich regions. The chondroadherin messenger RNA is present in chondrocytes at all ages.

Molecular Weight: 38 kDa (MW of target protein)