PCOLCE antibody (Middle Region)

Catalog No. ABIN634051

This Rabbit Polyclonal antibody specifically detects PCOLCE in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for PCOLCE antibody (Middle Region) (ABIN634051)

Target: PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCOLCE antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCOLCE Antibody

Binding Specificity: Middle Region

Specificity: PCOLCE antibody was raised against the middle region of PCOLCE

Purification: Affinity purified

Immunogen: PCOLCE antibody was raised using the middle region of PCOLCE corresponding to a region with amino acids LLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCOLCE Blocking Peptide, (ABIN5615262), is also available for use as a blocking control in assays to test for specificity of this PCOLCE antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCOLCE antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCOLCE

Target: PCOLCE (Procollagen C-Endopeptidase Enhancer (PCOLCE))

Alternative Name: PCOLCE

Background: PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity.

Molecular Weight: 48 kDa (MW of target protein)