KPNA2 antibody

Catalog No. ABIN634070

The Rabbit Polyclonal anti-KPNA2 antibody is suitable to detect KPNA2 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for KPNA2 antibody (ABIN634070)

Target: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This KPNA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-KPNA2 Antibody

Purification: Affinity purified

Immunogen: Karyopherin Alpha 2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GTDEQTQVVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Karyopherin Alpha 2 Blocking Peptide, (ABIN938988), is also available for use as a blocking control in assays to test for specificity of this Karyopherin Alpha 2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KPNA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for KPNA2

Target: KPNA2 (Karyopherin alpha 2 (RAG Cohort 1, Importin alpha 1) (KPNA2))

Alternative Name: Karyopherin alpha 2

Background: Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins.

Molecular Weight: 58 kDa (MW of target protein)

Pathways: M Phase, Protein targeting to Nucleus