CENPB antibody (C-Term)

Catalog No. ABIN634099

This Rabbit Polyclonal antibody specifically detects CENPB in WB. It exhibits reactivity toward Human.

Quick Overview for CENPB antibody (C-Term) (ABIN634099)

Target: CENPB (Centromere Protein B (CENPB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CENPB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CENPB Antibody

Binding Specificity: C-Term

Specificity: CENPB antibody was raised against the C terminal of CENPB

Purification: Affinity purified

Immunogen: CENPB antibody was raised using the C terminal of CENPB corresponding to a region with amino acids GGEDSDSDSEEEDDEEEDDEDEDDDDDEEDGDEVPVPSFGEAMAYFAMVK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CENPB Blocking Peptide, (ABIN938663), is also available for use as a blocking control in assays to test for specificity of this CENPB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CENPB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CENPB

Target: CENPB (Centromere Protein B (CENPB))

Alternative Name: CENPB

Background: CENPB is a highly conserved protein that facilitates centromere formation. It is a DNA-binding protein that is derived from transposases of the pogo DNA transposon family. It contains a helix-loop-helix DNA binding motif at the N-terminus, and a dimerization domain at the C-terminus. This protein is proposed to play an important role in the assembly of specific centromere structures in interphase nuclei and on mitotic chromosomes. It is also considered a major centromere autoantigen recognised by sera from patients with anti-centromere antibodies.

Molecular Weight: 65 kDa (MW of target protein)