Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Ubiquitin-Conjugating Enzyme E2C (UBE2C) antibody

Antigen

Ubiquitin-Conjugating Enzyme E2C (UBE2C)

Synonyms UBCH10, dJ447F3.2, LOC458287
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634161
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name UBE2C
Immunogen UBE2C antibody was raised using the middle region of UBE2C corresponding to a region with amino acids QGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNP
Description The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. UBE2C is a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for the destruction of mitotic cyclins and for cell cycle progression.
Molecular Weight 20 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of UBE2C antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "Ubiquitin-Conjugating Enzyme E2C (UBE2C)", type "Antibodies"
Hosts Mouse (8), Rabbit (8), Goat (6)
Reactivities Human (19)
Applications Western Blotting (WB) (21), Enzyme Immunoassay (EIA) (9), ELISA (8), Immunofluorescence (IF) (6), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoprecipitation (IP) (3)
Epitopes C-Term (3), N-Term (1), N-Term G25 (1)