PIK3R4 antibody (N-Term)

Catalog No. ABIN634200

The Rabbit Polyclonal anti-PIK3R4 antibody (ABIN634200) specifically detects PIK3R4 in WB. The antibody is reactive with Human samples.

Quick Overview for PIK3R4 antibody (N-Term) (ABIN634200)

Target: PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4 (PIK3R4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PIK3R4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PIK3R4 Antibody

Binding Specificity: N-Term

Specificity: PIK3 R4 antibody was raised against the N terminal of PIK3 4

Purification: Affinity purified

Immunogen: PIK3 R4 antibody was raised using the N terminal of PIK3 4 corresponding to a region with amino acids HDLPEKAEGEPKENGLVILVSVITSCLQTLKYCDSKLAALELILHLAPRL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PIK3R4 Blocking Peptide, (ABIN939096), is also available for use as a blocking control in assays to test for specificity of this PIK3R4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PIK0 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PIK3R4

Target: PIK3R4 (Phosphoinositide 3-kinase Regulatory Subunit 4 (PIK3R4))

Alternative Name: PIK3R4

Background: The protein can regulate subunit of the PI3K complex and may regulate membrane trafficking late in the endocytic pathway.

Molecular Weight: 153 kDa (MW of target protein)