»
Antibodies
»
anti-Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2) antibody
Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2) antibody
| Antigen |
|
| Synonyms |
p97, AAG1, DAP5, NAT1, FLJ41344, EIF4G2, NAT1B, eif4g2, hm:zeh1307, wu:fa14h01, wu:fb44h01, wu:fb59c06, wu:fc21b05, DKFZp459D102 |
| Clonality |
Polyclonal |
|
Host
|
|
|
Application
|
|
| Catalog no. |
ABIN634222 |
| Quantity |
50 ug (1 mg/ml) (Variants) |
| Price |
478.33 $ Plus shipping costs $35.00
|
| Shipping to |
|
| Availability |
Ships within 5 to 7 Business Days |
|
Alternative name
|
EIF4G2
|
|
Immunogen
|
EIF4G2 antibody was raised using the N terminal of EIF4G2 corresponding to a region with amino acids PNFDGPAAEGQPGQKQSTTFRRLLISKLQDEFENRTRNVDVYDKRENPLL
|
|
Description
|
Translation initiation is mediated by specific recognition of the cap structure by eukaryotic translation initiation factor 4F (eIF4F), which is a cap binding protein complex that consists of three subunits: eIF4A, eIF4E and eIF4G. EIF4G2 shares similarity with the C-terminal region of eIF4G that contains the binding sites for eIF4A and eIF3, eIF4G, in addition, contains a binding site for eIF4E at the N-terminus. Unlike eIF4G, which supports cap-dependent and independent translation, EIF4G2 functions as a general repressor of translation by forming translationally inactive complexes.
|
|
Molecular Weight
|
102 kDa (MW of target protein)
|
|
Concentration
|
1 mg/ml
|
|
Purification
|
Affinity purified
|
|
Buffer
|
Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of EIF4G2 antibody in PBS
|
|
Storage
|
Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
|
Alternatives for antigen "Eukaryotic Translation Initiation Factor 4 gamma 2 (EIF4G2)", type "Antibodies"