Inhibin alpha antibody (N-Term)

Catalog No. ABIN634265

The Rabbit Polyclonal anti-Inhibin alpha antibody is suitable to detect Inhibin alpha in samples from Human. It has been validated for WB.

Quick Overview for Inhibin alpha antibody (N-Term) (ABIN634265)

Target: Inhibin alpha (INHA) (Inhibin, alpha (INHA))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Inhibin alpha antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Inhibin alpha Antibody

Binding Specificity: N-Term

Specificity: Inhibin Alpha antibody was raised against the N terminal of INHA

Purification: Affinity purified

Immunogen: Inhibin Alpha antibody was raised using the N terminal of INHA corresponding to a region with amino acids GLAQEAEEGLFRYMFRPSQHTRSRQVTSAQLWFHTGLDRQGTAASNSSEP

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Inhibin Alpha Blocking Peptide, (ABIN938770), is also available for use as a blocking control in assays to test for specificity of this Inhibin Alpha antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of INHA antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Inhibin alpha

Target: Inhibin alpha (INHA) (Inhibin, alpha (INHA))

Alternative Name: Inhibin alpha

Background: INHA joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor activity. In addition, serum levels of inhibin have been shown to reflect the size of granulosa-cell tumors and can therefore be used as a marker for primary as well as recurrent disease. However, in prostate cancer, expression of the inhibin alpha-subunit gene was suppressed and was not detectable in poorly differentiated tumor cells. Furthermore, because expression in gonadal and various extragonadal tissues may vary severalfold in a tissue-specific fashion, it is proposed that inhibin may be both a growth/differentiation factor and a hormone.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism, Hormone Activity, Negative Regulation of Hormone Secretion