ACPP antibody (Middle Region)

Catalog No. ABIN634280

The Rabbit Polyclonal anti-ACPP antibody is suitable to detect ACPP in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for ACPP antibody (Middle Region) (ABIN634280)

Target: ACPP (Acid Phosphatase, Prostate (ACPP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACPP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACPP Antibody

Binding Specificity: Middle Region

Specificity: ACPP antibody was raised against the middle region of ACPP

Purification: Affinity purified

Immunogen: ACPP antibody was raised using the middle region of ACPP corresponding to a region with amino acids CESVHNFTLPSWATEDTMTKLRELSELSLLSLYGIHKQKEKSRLQGGVLV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACPP Blocking Peptide, (ABIN937065), is also available for use as a blocking control in assays to test for specificity of this ACPP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACPP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACPP

Target: ACPP (Acid Phosphatase, Prostate (ACPP))

Alternative Name: ACPP

Background: This gene encodes an enzyme that catalyzes the conversion of orthophosphoric monoester to alcohol and orthophosphate. It is synthesized under androgen regulation and is secreted by the epithelial cells of the prostate gland.

Molecular Weight: 41 kDa (MW of target protein)

Pathways: Synaptic Membrane, Ribonucleoside Biosynthetic Process