GNAI2 antibody

Catalog No. ABIN634285

This Rabbit Polyclonal antibody specifically detects GNAI2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for GNAI2 antibody (ABIN634285)

Target: GNAI2 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 2 (GNAI2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GNAI2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GNAI2 Antibody

Purification: Affinity purified

Immunogen: GNAI2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EYTGANKYDEAASYIQSKFEDLNKRKDTKEIYTHFTCATDTKNVQFVFDA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GNAI2 Blocking Peptide, (ABIN938216), is also available for use as a blocking control in assays to test for specificity of this GNAI2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNAI2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GNAI2

Target: GNAI2 (Guanine Nucleotide Binding Protein (G Protein), alpha Inhibiting Activity Polypeptide 2 (GNAI2))

Alternative Name: GNAI2

Background: Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. The G(i) proteins are involved in hormonal regulation of adenylate cyclase: they inhibit the cyclase in response to beta-adrenergic stimuli.

Molecular Weight: 40 kDa (MW of target protein)

Pathways: cAMP Metabolic Process, G-protein mediated Events, Thromboxane A2 Receptor Signaling