Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

E-Ras antibody

Antigen

E-Ras

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634304
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name ERAS
Immunogen ERAS antibody was raised using the middle region of ERAS corresponding to a region with amino acids AQPLVLVGNKCDLVTTAGDAHAAAAALAHSWGAHFVETSAKTRQGVEEAF
Description Ras proteins bind GDP/GTP and possess intrinsic GTPase activity. ERAS plays an important role in the tumor-like growth properties of embryonic stem cells.
Molecular Weight 25 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ERAS antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Embryogenesis, Embryonic stem cells, Transcription Factors

Alternatives

Alternatives for antigen "E-Ras", type "Antibodies"
Hosts Mouse (4), Rabbit (1)
Reactivities Human (3)
Applications Western Blotting (WB) (5), Immunofluorescence (IF) (3), ELISA (1)