RAB27A antibody (Middle Region)

Catalog No. ABIN634343

The Rabbit Polyclonal anti-RAB27A antibody is suitable to detect RAB27A in samples from Human. It has been validated for WB.

Quick Overview for RAB27A antibody (Middle Region) (ABIN634343)

Target: RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RAB27A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RAB27A Antibody

Binding Specificity: Middle Region

Specificity: RAB27 A antibody was raised against the middle region of RAB27

Purification: Affinity purified

Immunogen: RAB27 A antibody was raised using the middle region of RAB27 corresponding to a region with amino acids SQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RAB27A Blocking Peptide, (ABIN5615702), is also available for use as a blocking control in assays to test for specificity of this RAB27A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAB20 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RAB27A

Target: RAB27A (RAB27A, Member RAS Oncogene Family (RAB27A))

Alternative Name: RAB27A

Background: The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. The protein is membrane-bound and may be involved in protein transport and small GTPase mediated signal transduction.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: Peptide Hormone Metabolism