SHB antibody (N-Term)

Catalog No. ABIN634362

The Rabbit Polyclonal anti-SHB antibody (ABIN634362) specifically detects SHB in WB. The antibody is reactive with Human and Mouse samples.

Quick Overview for SHB antibody (N-Term) (ABIN634362)

Target: SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SHB Antibody

Binding Specificity: N-Term

Specificity: SHB antibody was raised against the N terminal of SHB

Purification: Affinity purified

Immunogen: SHB antibody was raised using the N terminal of SHB corresponding to a region with amino acids MAKWLNKYFSLGNSKTKSPPQPPRPDYREQRRRGERPSQPPQAVPQASSA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SHB Blocking Peptide, (ABIN5616129), is also available for use as a blocking control in assays to test for specificity of this SHB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SHB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHB

Target: SHB (Src Homology 2 Domain Containing Adaptor Protein B (SHB))

Alternative Name: SHB

Background: SHB is the adapter protein which regulates several signal transduction cascades by linking activated receptors to downstream signaling components. SHB may play a role in angiogenesis by regulating FGFR1, VEGFR2 and PDGFR signaling.

Molecular Weight: 55 kDa (MW of target protein)