CD160 antibody (Middle Region)

Catalog No. ABIN634374

The Rabbit Polyclonal anti-CD160 antibody (ABIN634374) specifically detects CD160 in WB. The antibody is reactive with Human samples.

Quick Overview for CD160 antibody (Middle Region) (ABIN634374)

Target: CD160

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CD160 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CD160 Antibody

Binding Specificity: Middle Region

Specificity: CD160 antibody was raised against the middle region of CD160

Purification: Affinity purified

Immunogen: CD160 antibody was raised using the middle region of CD160 corresponding to a region with amino acids SGTYQCCARSQKSGIRLQGHFFSILFTETGNYTVTGLKQRQHLEFSHNEG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CD160 Blocking Peptide, (ABIN5612745), is also available for use as a blocking control in assays to test for specificity of this CD160 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CD160 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CD160

Target: CD160

Alternative Name: CD160

Background: CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity.

Molecular Weight: 20 kDa (MW of target protein)