CANT1 antibody (Middle Region)

Catalog No. ABIN634381

This Rabbit Polyclonal antibody specifically detects CANT1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for CANT1 antibody (Middle Region) (ABIN634381)

Target: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CANT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CANT1 Antibody

Binding Specificity: Middle Region

Specificity: CANT1 antibody was raised against the middle region of CANT1

Purification: Affinity purified

Immunogen: CANT1 antibody was raised using the middle region of CANT1 corresponding to a region with amino acids SPDFGDIAVSHVGAVVPTHGFSSFKFIPNTDDQIIVALKSEEDSGRVASY

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CANT1 Blocking Peptide, (ABIN5612599), is also available for use as a blocking control in assays to test for specificity of this CANT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CANT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CANT1

Target: CANT1 (Calcium Activated Nucleotidase 1 (CANT1))

Alternative Name: CANT1

Background: CANT1 belongs to the apyrase family.It is a calcium-dependent nucleotidase with a preference for UDP. The order of activity with different substrates is UDP > GDP > UTP > GTP. The enzyme has very low activity towards ADP and even lower activity towards ATP.

Molecular Weight: 45 kDa (MW of target protein)