SAMHD1 antibody (Middle Region)

Catalog No. ABIN634417

This Rabbit Polyclonal antibody specifically detects SAMHD1 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for SAMHD1 antibody (Middle Region) (ABIN634417)

Target: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SAMHD1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SAMHD1 Antibody

Binding Specificity: Middle Region

Specificity: SAMHD1 antibody was raised against the middle region of SAMHD1

Purification: Affinity purified

Immunogen: SAMHD1 antibody was raised using the middle region of SAMHD1 corresponding to a region with amino acids KGRPENKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQNNFDYKRFIKF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SAMHD1 Blocking Peptide, (ABIN939791), is also available for use as a blocking control in assays to test for specificity of this SAMHD1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAMHD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SAMHD1

Target: SAMHD1 (SAM Domain and HD Domain 1 (SAMHD1))

Alternative Name: SAMHD1

Background: SAMHD1 contains 1 HD domain and 1 SAM (sterile alpha motif) domain. SAMHD1 may play a role in mediating proinflammatory responses to TNF-alpha signaling.

Molecular Weight: 72 kDa (MW of target protein)