DNAJC27 antibody (Middle Region)

Catalog No. ABIN634448

The Rabbit Polyclonal anti-DNAJC27 antibody is suitable to detect DNAJC27 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for DNAJC27 antibody (Middle Region) (ABIN634448)

Target: DNAJC27 (DnaJ (Hsp40) Homolog, Subfamily C, Member 27 (DNAJC27))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJC27 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNAJC27 Antibody

Binding Specificity: Middle Region

Specificity: RBJ antibody was raised against the middle region of RBJ

Purification: Affinity purified

Immunogen: RBJ antibody was raised using the middle region of RBJ corresponding to a region with amino acids CVDESEGRLWAESKGFLYFETSAQTGEGINEMFQTFYISIVDLCENGGKR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RBJ Blocking Peptide, (ABIN937215), is also available for use as a blocking control in assays to test for specificity of this RBJ antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RBJ antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJC27

Target: DNAJC27 (DnaJ (Hsp40) Homolog, Subfamily C, Member 27 (DNAJC27))

Alternative Name: RBJ

Background: The function of RBJ protein has not been widely studied, and is yet to be fully elucidated.

Molecular Weight: 31 kDa (MW of target protein)