Lipocalin 1 antibody

Catalog No. ABIN634487

The Rabbit Polyclonal anti-Lipocalin 1 antibody is suitable to detect Lipocalin 1 in samples from Human. It has been validated for WB.

Quick Overview for Lipocalin 1 antibody (ABIN634487)

Target: Lipocalin 1 (LCN1)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Lipocalin 1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Lipocalin 1 Antibody

Purification: Affinity purified

Immunogen: Lipocalin 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids IRSHVKDHYIFYCEGELHGKPVRGVKLVGRDPKNNLEALEDFEKAAGARG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Lipocalin 1 Blocking Peptide, (ABIN939526), is also available for use as a blocking control in assays to test for specificity of this Lipocalin 1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LCN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Lipocalin 1

Target: Lipocalin 1 (LCN1)

Alternative Name: Lipocalin 1

Background: LCN1 could play a role in taste reception. LCN1 could be necessary for the concentration and delivery of sapid molecules in the gustatory system. LCN1 can bind various ligands, with chemical structures ranging from lipids and retinoids to the macrocyclic antibiotic rifampicin and even to microbial siderophores. LCN1 exhibits an extremely wide ligand pocket.

Molecular Weight: 17 kDa (MW of target protein)