Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ADAM Metallopeptidase Domain 33 (ADAM33) antibody

Antigen

ADAM Metallopeptidase Domain 33 (ADAM33)

Synonyms FLJ35308, FLJ36751, MGC71889, C20orf153, DJ964F7.1, MGC149823, DKFZp434K0521, Adaml, ADAM13, ADAM33
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634549
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name ADAM33
Immunogen ADAM33 antibody was raised using the middle region of ADAM33 corresponding to a region with amino acids HDSAQLLTGRAFQGATVGLAPVEGMCRAESSGGVSTDHSELPIGAAATMA
Description ADAM33 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM33 is a type I transmembrane protein implicated in asthma and bronchial hyperresponsiveness.
Molecular Weight 62 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM33 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Proteolysis / Ubiquitin, Metalloprotease, Extracellular Matrix, Proteases

Alternatives

Alternatives for antigen "ADAM Metallopeptidase Domain 33 (ADAM33)", type "Antibodies"
Hosts Goat (4), Rabbit (2), Mouse (1)
Reactivities Human (6)
Applications Western Blotting (WB) (6), ELISA (2), Enzyme Immunoassay (EIA) (2)