SHISA5 antibody (Middle Region)

Catalog No. ABIN634555

This Rabbit Polyclonal antibody specifically detects SHISA5 in WB. It exhibits reactivity toward Human.

Quick Overview for SHISA5 antibody (Middle Region) (ABIN634555)

Target: SHISA5 (Shisa Homolog 5 (SHISA5))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SHISA5 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SHISA5 Antibody

Binding Specificity: Middle Region

Specificity: SCOTIN antibody was raised against the middle region of Scotin

Purification: Affinity purified

Immunogen: SCOTIN antibody was raised using the middle region of Scotin corresponding to a region with amino acids CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SCOTIN Blocking Peptide, (ABIN937034), is also available for use as a blocking control in assays to test for specificity of this SCOTIN antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCOTIN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SHISA5

Target: SHISA5 (Shisa Homolog 5 (SHISA5))

Alternative Name: SCOTIN

Background: This protein can induce apoptosis in a caspase-dependent manner and plays a role in p53/TP53-dependent apoptosis.

Molecular Weight: 25 kDa (MW of target protein)