C1QB antibody (C-Term)

Catalog No. ABIN634558

This Rabbit Polyclonal antibody specifically detects C1QB in IHC and WB. It exhibits reactivity toward Human.

Quick Overview for C1QB antibody (C-Term) (ABIN634558)

Target: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This C1QB antibody is un-conjugated

Application: Immunohistochemistry (IHC), Western Blotting (WB)

Product Details anti-C1QB Antibody

Binding Specificity: C-Term

Specificity: C1 QB antibody was raised against the C terminal of C1 B

Purification: Affinity purified

Immunogen: C1 QB antibody was raised using the C terminal of C1 B corresponding to a region with amino acids AYNTFQVTTGGMVLKLEQGENVFLQATDKNSLLGMEGANSIFSGFLLFPD

Application Details

Application Notes: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

C1QB Blocking Peptide, (ABIN937017), is also available for use as a blocking control in assays to test for specificity of this C1QB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 B antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for C1QB

Target: C1QB (Complement Component 1, Q Subcomponent, B Chain (C1QB))

Alternative Name: C1QB

Background: C1QB is a major constituent of the human complement subcomponent C1q. C1q associates with C1r and C1s in order to yield the first component of the serum complement system. Deficiency of C1q has been associated with lupus erythematosus and glomerulonephritis. C1q is composed of 18 polypeptide chains: six A-chains, six B-chains, and six C-chains. Each chain contains a collagen-like region located near the N terminus and a C-terminal globular region. The A-, B-, and C-chains are arranged in the order A-C-B on chromosome 1. C1QB is the B-chain polypeptide of human complement subcomponent C1q.

Molecular Weight: 27 kDa (MW of target protein)

Pathways: Complement System