PHLDA2 antibody (Middle Region)

Catalog No. ABIN634590

The Rabbit Polyclonal anti-PHLDA2 antibody (ABIN634590) specifically detects PHLDA2 in WB. The antibody is reactive with Human samples.

Quick Overview for PHLDA2 antibody (Middle Region) (ABIN634590)

Target: PHLDA2 (Pleckstrin Homology-Like Domain, Family A, Member 2 (PHLDA2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PHLDA2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PHLDA2 Antibody

Binding Specificity: Middle Region

Specificity: PHLDA2 antibody was raised against the middle region of PHLDA2

Purification: Affinity purified

Immunogen: PHLDA2 antibody was raised using the middle region of PHLDA2 corresponding to a region with amino acids QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PHLDA2 Blocking Peptide, (ABIN5615351), is also available for use as a blocking control in assays to test for specificity of this PHLDA2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PHLDA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PHLDA2

Target: PHLDA2 (Pleckstrin Homology-Like Domain, Family A, Member 2 (PHLDA2))

Alternative Name: PHLDA2

Background: This gene is one of several genes in the imprinted gene domain of 11p15.5 which is considered to be an important tumor suppressor gene region. Alterations in this region may be associated with the Beckwith-Wiedemann syndrome, Wilms tumor and rhabdomyosarcoma.

Molecular Weight: 17 kDa (MW of target protein)

Pathways: Regulation of Carbohydrate Metabolic Process