ELMO3 antibody (Middle Region)

Catalog No. ABIN634591

This Rabbit Polyclonal antibody specifically detects ELMO3 in WB. It exhibits reactivity toward Human and Mouse.

Quick Overview for ELMO3 antibody (Middle Region) (ABIN634591)

Target: ELMO3 (Engulfment and Cell Motility 3 (ELMO3))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ELMO3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ELMO3 Antibody

Binding Specificity: Middle Region

Specificity: ELMO3 antibody was raised against the middle region of ELMO3

Purification: Affinity purified

Immunogen: ELMO3 antibody was raised using the middle region of ELMO3 corresponding to a region with amino acids RKLGFSNSNPAQDLERVPPGLLALDNMLYFSRNAPSAYSRFVLENSSRED

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ELMO3 Blocking Peptide, (ABIN5613360), is also available for use as a blocking control in assays to test for specificity of this ELMO3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ELMO3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ELMO3

Target: ELMO3 (Engulfment and Cell Motility 3 (ELMO3))

Alternative Name: ELMO3

Background: ELMO3 is similar to a C. elegans protein that functions in phagocytosis of apoptotic cells and in cell migration. Other members of this small family of engulfment and cell motility (ELMO) proteins have been shown to interact with the dedicator of cyto-kinesis 1 protein to promote phagocytosis and effect cell shape changes.

Molecular Weight: 87 kDa (MW of target protein)