Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ADAM-Like, Decysin 1 (ADAMDEC1) antibody

Antigen

ADAM-Like, Decysin 1 (ADAMDEC1)

Synonyms M12.219, FLJ79219, Dcsn, AI574231, 2210414L24Rik, ADAMDEC1
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634635
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name ADAMDEC1
Immunogen ADAMDEC1 antibody was raised using the middle region of ADAMDEC1 corresponding to a region with amino acids GMPDVPFNTKCPSGSCVMNQYLSSKFPKDFSTSCRAHFERYLLSQKPKCL
Description This encoded protein is thought to be a secreted protein belonging to the disintegrin metalloproteinase family. Its expression is upregulated during dendritic cells maturation.
Molecular Weight 53 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAMDEC1 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Proteolysis / Ubiquitin, Metalloprotease

Alternatives

Alternatives for antigen "ADAM-Like, Decysin 1 (ADAMDEC1)", type "Antibodies"
Hosts Mouse (6), Rabbit (3)
Reactivities Human (7), Mouse (Murine) (2)
Applications Western Blotting (WB) (9), ELISA (4), Enzyme Immunoassay (EIA) (3), Immunohistochemistry (IHC) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2)