Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Laminin, beta 3 (LAMB3) antibody

Antigen

Laminin, beta 3 (LAMB3)

Synonyms LAM5, LAMNB1, FLJ99565, BM600-125KDA, LAMB3, MGC143240, lam5, lamnb1
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN634648
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name Laminin Beta 3
Immunogen Laminin Beta 3 antibody was raised using the middle region of LAMB3 corresponding to a region with amino acids ERIKQKYAELKDRLGQSSMLGEQGARIQSVKTEAEELFGETMEMMDRMKD
Description The product encoded by this gene is a laminin that belongs to a family of basement membrane proteins. This protein is a beta subunit laminin, which together with an alpha and a gamma subunit, forms laminin-5.
Molecular Weight 128 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LAMB3 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.

Alternatives

Alternatives for antigen "Laminin, beta 3 (LAMB3)", type "Antibodies"
Hosts Mouse (5), Rabbit (2)
Reactivities Human (7)
Applications Western Blotting (WB) (6), ELISA (5), Immunofluorescence (IF) (3), Enzyme Immunoassay (EIA) (2), Immunohistochemistry (IHC) (1)