LGALS3BP antibody (Middle Region)

Catalog No. ABIN634658

There is 1 publication for this product available. The Rabbit Polyclonal anti-LGALS3BP antibody is suitable to detect LGALS3BP in samples from Human and Mouse. It has been validated for WB.

Quick Overview for LGALS3BP antibody (Middle Region) (ABIN634658)

Target: LGALS3BP (Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP))

Reactivity: Human, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This LGALS3BP antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-LGALS3BP Antibody

Binding Specificity: Middle Region

Specificity: LGALS3 BP antibody was raised against the middle region of LGALS3 P

Purification: Affinity purified

Immunogen: LGALS3 BP antibody was raised using the middle region of LGALS3 P corresponding to a region with amino acids NLSLYWSHEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPRIYTS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

LGALS3BP Blocking Peptide, (ABIN5614449), is also available for use as a blocking control in assays to test for specificity of this LGALS3BP antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LGALS0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

References for anti-LGALS3BP antibody (ABIN634658)

Langley, Willeit, Didangelos, Matic, Skroblin, Barallobre-Barreiro, Lengquist, Rungger, Kapustin, Kedenko, Molenaar, Lu, Barwari, Suna, Yin, Iglseder, Paulweber, Willeit, Shalhoub, Pasterkamp, Davies et al.: "Extracellular matrix proteomics identifies molecular signature of symptomatic carotid plaques. ..." in: The Journal of clinical investigation, Vol. 127, Issue 4, pp. 1546-1560, (2017) (PubMed).

Target Details for LGALS3BP

Target: LGALS3BP (Lectin, Galactoside-Binding, Soluble, 3 Binding Protein (LGALS3BP))

Alternative Name: LGALS3BP

Background: The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

Molecular Weight: 63 kDa (MW of target protein)