ADAM15 antibody (Middle Region)

Catalog No. ABIN634676

The Rabbit Polyclonal anti-ADAM15 antibody is suitable to detect ADAM15 in samples from Human, Mouse and Rat. It has been validated for WB.

Quick Overview for ADAM15 antibody (Middle Region) (ABIN634676)

Target: ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM15 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADAM15 Antibody

Binding Specificity: Middle Region

Specificity: ADAM15 antibody was raised against the middle region of ADAM15

Purification: Affinity purified

Immunogen: ADAM15 antibody was raised using the middle region of ADAM15 corresponding to a region with amino acids QPAAPLCLQTANTRGNAFGSCGRNPSGSYVSCTPRDAICGQLQCQTGRTQ

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM15 Blocking Peptide, (ABIN5611932), is also available for use as a blocking control in assays to test for specificity of this ADAM15 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM15 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM15

Target: ADAM15 (ADAM Metallopeptidase Domain 15 (ADAM15))

Alternative Name: ADAM15

Background: ADAM15 is a member of the ADAM (a disintegrin and metalloproteinase) protein family. ADAM family members are type I transmembrane glycoproteins known to be involved in cell adhesion and proteolytic ectodomain processing of cytokines and adhesion molecules. This protein contains multiple functional domains including a zinc-binding metalloprotease domain, a disintegrin-like domain, as well as a EGF-like domain.

Molecular Weight: 70 kDa (MW of target protein)