PCDHB13 antibody (Middle Region)

Catalog No. ABIN634692

The Rabbit Polyclonal anti-PCDHB13 antibody (ABIN634692) specifically detects PCDHB13 in WB. The antibody is reactive with Human samples.

Quick Overview for PCDHB13 antibody (Middle Region) (ABIN634692)

Target: PCDHB13 (Protocadherin beta 13 (PCDHB13))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PCDHB13 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PCDHB13 Antibody

Binding Specificity: Middle Region

Specificity: PCDHB13 antibody was raised against the middle region of PCDHB13

Purification: Affinity purified

Immunogen: PCDHB13 antibody was raised using the middle region of PCDHB13 corresponding to a region with amino acids GKTFKINPLTGEIELKKQLDFEKLQSYEVNIEARDAGTFSGKCTVLIQVI

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PCDHB13 Blocking Peptide, (ABIN938764), is also available for use as a blocking control in assays to test for specificity of this PCDHB13 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PCDHB13 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PCDHB13

Target: PCDHB13 (Protocadherin beta 13 (PCDHB13))

Alternative Name: PCDHB13

Background: PCDHB13 is a member of the protocadherin beta gene cluster, one of three related gene clusters tandemly linked on chromosome five. The gene clusters demonstrate an unusual genomic organization similar to that of B-cell and T-cell receptor gene clusters. The beta cluster contains 16 genes and 3 pseudogenes, each encoding 6 extracellular cadherin domains and a cytoplasmic tail that deviates from others in the cadherin superfamily.

Molecular Weight: 85 kDa (MW of target protein)