ADAM2 antibody

Catalog No. ABIN634702

This Rabbit Polyclonal antibody specifically detects ADAM2 in WB. It exhibits reactivity toward Human.

Quick Overview for ADAM2 antibody (ABIN634702)

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADAM2 Antibody

Purification: Affinity purified

Immunogen: ADAM2 antibody was raised using a synthetic peptide corresponding to a region with amino acids PHDVAFLLVYREKSNYVGATFQGKMCDANYAGGVVLHPRTISLESLAVIL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ADAM2 Blocking Peptide, (ABIN5611934), is also available for use as a blocking control in assays to test for specificity of this ADAM2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ADAM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ADAM2

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Alternative Name: ADAM2

Background: ADAM2 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM2 is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions.

Molecular Weight: 81 kDa (MW of target protein)