Cholecystokinin antibody (Middle Region)

Catalog No. ABIN634802

The Rabbit Polyclonal anti-Cholecystokinin antibody is suitable to detect Cholecystokinin in samples from Human. It has been validated for WB.

Quick Overview for Cholecystokinin antibody (Middle Region) (ABIN634802)

Target: Cholecystokinin (CCK)

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Cholecystokinin antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-Cholecystokinin Antibody

Binding Specificity: Middle Region

Specificity: CCK antibody was raised against the middle region of CCK

Purification: Affinity purified

Immunogen: CCK antibody was raised using the middle region of CCK corresponding to a region with amino acids IQQARKAPSGRMSIVKNLQNLDPSHRISDRDYMGWMDFGRRSAEEYEYPS

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CCK Blocking Peptide, (ABIN939507), is also available for use as a blocking control in assays to test for specificity of this CCK antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CCK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for Cholecystokinin

Target: Cholecystokinin (CCK)

Alternative Name: CCK

Background: Cholecystokinin (CCK) is a brain/gut peptide. In the gut, it induces the release of pancreatic enzymes and the contraction of the gallbladder. In the brain, its physiologic role is unclear. The cholecystokinin pro-hormone is processed by endo- and exo-proteolytic cleavages.

Molecular Weight: 13 kDa (MW of target protein)

Pathways: TCR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Positive Regulation of Immune Effector Process, Positive Regulation of Endopeptidase Activity, Toll-Like Receptors Cascades, Feeding Behaviour