PI16 antibody (Middle Region)

Catalog No. ABIN634818

The Rabbit Polyclonal anti-PI16 antibody (ABIN634818) specifically detects PI16 in WB. The antibody is reactive with Human samples.

Quick Overview for PI16 antibody (Middle Region) (ABIN634818)

Target: PI16 (Peptidase Inhibitor 16 (PI16))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PI16 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PI16 Antibody

Binding Specificity: Middle Region

Specificity: PI16 antibody was raised against the middle region of PI16

Purification: Affinity purified

Immunogen: PI16 antibody was raised using the middle region of PI16 corresponding to a region with amino acids SKSLPNFPNTSATANATGGRALALQSSLPGAEGPDKPSVVSGLNSGPGHV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

PI16 Blocking Peptide, (ABIN5615358), is also available for use as a blocking control in assays to test for specificity of this PI16 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PI16 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for PI16

Target: PI16 (Peptidase Inhibitor 16 (PI16))

Alternative Name: PI16

Background: PI16 is a putative serine protease inhibitor. PI16 may serve as a marker following prostatectomy for prostate cancer.

Molecular Weight: 47 kDa (MW of target protein)