B3GALNT1 antibody

Catalog No. ABIN634919

The Rabbit Polyclonal anti-B3GALNT1 antibody is suitable to detect B3GALNT1 in samples from Human. It has been validated for WB.

Quick Overview for B3GALNT1 antibody (ABIN634919)

Target: B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This B3GALNT1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-B3GALNT1 Antibody

Purification: Affinity purified

Immunogen: B3 GALNT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids PRIYEMMGHVKPIKFEDVYVGICLNLLKVNIHIPEDTNLFFLYRIHLDVC

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

B3GALNT1 Blocking Peptide, (ABIN5612253), is also available for use as a blocking control in assays to test for specificity of this B3GALNT1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of B0 ALNT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for B3GALNT1

Target: B3GALNT1 (beta-1,3-N-Acetylgalactosaminyltransferase 1 (B3GALNT1))

Alternative Name: B3GALNT1

Background: This gene is a member of the beta-1,3-galactosyltransferase (beta3GalT) gene family. B3GALNT1 is type II membrane-bound glycoproteins with diverse enzymatic functions using different donor substrates.

Molecular Weight: 39 kDa (MW of target protein)