CMTM8 antibody (Middle Region)

Catalog No. ABIN634936

This Rabbit Polyclonal antibody specifically detects CMTM8 in WB. It exhibits reactivity toward Human.

Quick Overview for CMTM8 antibody (Middle Region) (ABIN634936)

Target: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This CMTM8 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-CMTM8 Antibody

Binding Specificity: Middle Region

Specificity: CMTM8 antibody was raised against the middle region of CMTM8

Purification: Affinity purified

Immunogen: CMTM8 antibody was raised using the middle region of CMTM8 corresponding to a region with amino acids CFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

CMTM8 Blocking Peptide, (ABIN937072), is also available for use as a blocking control in assays to test for specificity of this CMTM8 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM8 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for CMTM8

Target: CMTM8 (CKLF-Like MARVEL Transmembrane Domain Containing 8 (CMTM8))

Alternative Name: CMTM8

Background: Cmtm8 gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown.

Molecular Weight: 19 kDa (MW of target protein)