SLC25A4 antibody

Catalog No. ABIN635077

This Rabbit Polyclonal antibody specifically detects SLC25A4 in WB. It exhibits reactivity toward Human.

Quick Overview for SLC25A4 antibody (ABIN635077)

Target: SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC25A4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC25A4 Antibody

Purification: Affinity purified

Immunogen: SLC25 A4 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLQVQHASKQISAEKQYKGIIDCVVRIPKEQGFLSFWRGNLANVIRYFPT

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC25A4 Blocking Peptide, (ABIN5616226), is also available for use as a blocking control in assays to test for specificity of this SLC25A4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC25A4

Target: SLC25A4 (Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 4 (SLC25A4))

Alternative Name: SLC25A4

Background: This gene is a member of the mitochondrial carrier subfamily of solute carrier protein genes. The product of this gene functions as a gated pore that translocates ADP from the mitochondrial matrix into the cytoplasm. The protein forms a homodimer embedded in the inner mitochondria membrane. Mutations in this gene have been shown to result in autosomal dominant progressive external opthalmoplegia and familial hypertrophic cardiomyopathy.

Molecular Weight: 33 kDa (MW of target protein)

Pathways: Proton Transport, Dicarboxylic Acid Transport