ABCC3 antibody

Catalog No. ABIN635289

The Rabbit Polyclonal anti-ABCC3 antibody (ABIN635289) specifically detects ABCC3 in WB. The antibody is reactive with Human samples.

Quick Overview for ABCC3 antibody (ABIN635289)

Target: ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ABCC3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ABCC3 Antibody

Purification: Affinity purified

Immunogen: ABCC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids KVHMKGSVAYVPQQAWIQNCTLQENVLFGKALNPKRYQQTLEACALLADL

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ABCC3 Blocking Peptide, (ABIN940093), is also available for use as a blocking control in assays to test for specificity of this ABCC3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ABCC3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ABCC3

Target: ABCC3 (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 3 (ABCC3))

Alternative Name: ABCC3

Background: ABCC3 is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MRP subfamily which is involved in multi-drug resistance. The specific function of this protein has not yet been determined, however, this protein may play a role in the transport of biliary and intestinal excretion of organic anions. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.

Molecular Weight: 168 kDa (MW of target protein)