Add to Basket
Order hotline:
 |
+1 404 474 4654 |
 |
+1 888 205 9894 (TF) |
Lamin B Receptor (LBR) antibody
| Antigen | Lamin B Receptor (LBR) |
| Synonyms | PHA, LMN2R, DHCR14B, MGC9041, FLJ43126, dLBR, DmelCG17952, CG17952, Nbp60, ic, AI505894, sb:cb406, zgc:86649, wu:fb75h08, wu:fc47b04, wu:fd36b07, lbr-A, Xp58, p58 gene, LBR, DKFZp469G1019 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Application |
Alternatives Western Blotting (WB)
|
| Catalog no. | ABIN635330 |
| Quantity | 50 ug (1 mg/ml) |
| Price | 478.33 $ Plus shipping costs $35.00 |
| Shipping to |
|
| Availability | Ships within 5 to 7 Business Days |
Additional Information
| Alternative name | Lamin B Receptor |
| Immunogen | Lamin B Receptor antibody was raised using the middle region of LBR corresponding to a region with amino acids GANSQKNAFRKNPSDPKLAHLKTIHTSTGKNLLVSGWWGFVRHPNYLGDL |
| Description | The protein encoded by this gene belongs to the ERG4/ERG24 family. It is localized in the nuclear envelope inner membrane and anchors the lamina and the heterochromatin to the membrane. It may mediate interaction between chromatin and lamin B. Mutations of this gene has been associated with autosomal recessive HEM/Greenberg skeletal dysplasia. Alternative splicing occurs at this locus and two transcript variants encoding the same protein have been identified. |
| Molecular Weight | 71 kDa (MW of target protein) |
Application Details
| Concentration | 1 mg/ml |
| Purification | Affinity purified |
| Buffer | Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of LBR antibody in PBS |
| Storage | Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles. |
Alternatives
Alternatives for antigen "Lamin B Receptor (LBR)", type "Antibodies"
| Hosts | Rabbit (20), Mouse (1) |
| Reactivities | Human (21), Mouse (Murine) (19), Rat (Rattus) (19), Pig (Porcine) (2), Chicken (1), Cow (Bovine) (1), Dog (Canine) (1), Rabbit (1) |
| Applications | Immunofluorescence (IF) (19), Flow Cytometry (FACS) (18), Western Blotting (WB) (4), ELISA (3), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunoprecipitation (IP) (2), ELISA (Detection) (1), Immunoelectron Microscopy (IEM) (1) |
| Conjugates | Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1) |
