SLC5A9 antibody

Catalog No. ABIN635363

The Rabbit Polyclonal anti-SLC5A9 antibody is suitable to detect SLC5A9 in samples from Human. It has been validated for WB.

Quick Overview for SLC5A9 antibody (ABIN635363)

Target: SLC5A9 (Solute Carrier Family 5 (Sodium/glucose Cotransporter), Member 9 (SLC5A9))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC5A9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC5A9 Antibody

Purification: Affinity purified

Immunogen: SLC5 A9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC5A9 Blocking Peptide, (ABIN5616270), is also available for use as a blocking control in assays to test for specificity of this SLC5A9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC5A9

Target: SLC5A9 (Solute Carrier Family 5 (Sodium/glucose Cotransporter), Member 9 (SLC5A9))

Alternative Name: SLC5A9

Background: SLC5A9 is involved in sodium-dependent transport of D-mannose, D-glucose and D-fructose.

Molecular Weight: 76 kDa (MW of target protein)